PDB entry 2w6y

View 2w6y on RCSB PDB site
Description: crystal structure of sperm whale myoglobin mutant yqr in complex with xenon
Class: oxygen storage
Keywords: hydrophobic cavities, oxygen storage, oxygen transport, xenon docking site, iron, heme, transport, metal-binding, muscle protein
Deposited on 2008-12-19, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (29)
      • engineered mutation (64)
      • engineered mutation (67)
    Domains in SCOPe 2.07: d2w6ya_
  • Heterogens: HEM, SO4, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w6yA (A:)
    mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w6yA (A:)
    vlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkased
    lkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg