PDB entry 2w6x

View 2w6x on RCSB PDB site
Description: crystal structure of sperm whale myoglobin mutant yqrf in complex with xenon
Class: oxygen storage
Keywords: hydrophobic cavities, distal site point mutation, oxygen storage, oxygen transport, xenon docking site, iron, heme, transport, metal-binding, muscle protein
Deposited on 2008-12-19, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.161
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (29)
      • engineered mutation (64)
      • engineered mutation (67)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d2w6xa_
  • Heterogens: HEM, XE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w6xA (A:)
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikyleffseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg