PDB entry 2w6w

View 2w6w on RCSB PDB site
Description: crystal structure of recombinant sperm whale myoglobin under 1atm of xenon
Class: oxygen storage
Keywords: hydrophobic cavities, oxygen storage, oxygen transport, xenon docking site, iron, heme, transport, metal-binding, muscle protein
Deposited on 2008-12-19, released 2009-04-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2w6wa_
  • Heterogens: HEM, XE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w6wA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w6wA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg