PDB entry 2w6b

View 2w6b on RCSB PDB site
Description: crystal structure of the trimeric beta-pix coiled-coil domain
Deposited on 2008-12-17, released 2009-01-20
The last revision was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.279
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W6B (Start-4)
    • Uniprot O55043 (5-55)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w6bA (A:)
gplgskslvdtvyalkdevqelrqdnkkmkksleeeqrarkdleklvrkvlknmnd

    Sequence, based on observed residues (ATOM records):
    >2w6bA (A:)
skslvdtvyalkdevqelrqdnkkmkksleeeqrarkdleklvrkvlknmnd