PDB entry 2w6a

View 2w6a on RCSB PDB site
Description: x-ray structure of the dimeric git1 coiled-coil domain
Deposited on 2008-12-17, released 2009-01-20
The last revision was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.163
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ARF GTPase-activating protein GIT1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W6A (0-End)
    • Uniprot Q9Z272 (Start-62)
  • Chain 'B':
    Compound: ARF GTPase-activating protein GIT1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w6aA (A:)
gplgssdgavtlqeylelkkalatseakvqqlmkvnsslsdelrklqreihklqaenlql
rqp

    Sequence, based on observed residues (ATOM records):
    >2w6aA (A:)
gplgdgavtlqeylelkkalatseakvqqlmkvnsslsdelrklqreihklqaenlqlrq
p

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2w6aB (B:)
gplgssdgavtlqeylelkkalatseakvqqlmkvnsslsdelrklqreihklqaenlql
rqp

    Sequence, based on observed residues (ATOM records):
    >2w6aB (B:)
dgavtlqeylelkkalatseakvqqlmkvnsslsdelrklqreihklqaenlqlrq