PDB entry 2w69

View 2w69 on RCSB PDB site
Description: influenza polymerase fragment
Class: transcription
Keywords: RNA-dependent, RNA polymerase, transcription
Deposited on 2008-12-17, released 2009-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.22
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31343 (7-End)
      • expression tag (6)
      • conflict (160)
    Domains in SCOPe 2.06: d2w69a1, d2w69a2
  • Chain 'B':
    Compound: Polymerase acidic protein
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31343 (7-End)
      • expression tag (6)
      • conflict (160)
    Domains in SCOPe 2.06: d2w69b1, d2w69b2
  • Chain 'D':
    Compound: Polymerase acidic protein
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31343 (7-End)
      • expression tag (6)
      • conflict (160)
    Domains in SCOPe 2.06: d2w69d1, d2w69d2
  • Heterogens: MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w69A (A:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhf
    ineqgesivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydyk
    enrfieigvtrrevhiyylekankiksenthihifsftgeematkadytldeesrarikt
    rlftirqemanrglwdsfrqsergeetieerfeitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w69A (A:)
    amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
    sivvelddpnalkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfiei
    gvtrrevhiyylekankiksthihifsftgeematkadytldeesrariktrlftirqem
    anrglwdsfrqser
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w69B (B:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhf
    ineqgesivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydyk
    enrfieigvtrrevhiyylekankiksenthihifsftgeematkadytldeesrarikt
    rlftirqemanrglwdsfrqsergeetieerfeitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w69B (B:)
    amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
    sivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfie
    igvtrrevhiyylekankiksenthihifsftgeematkadytldeesrariktrlftir
    qemanrglwdsfrqser
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w69D (D:)
    gmgsgmamedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhf
    ineqgesivvelddpnallkhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydyk
    enrfieigvtrrevhiyylekankiksenthihifsftgeematkadytldeesrarikt
    rlftirqemanrglwdsfrqsergeetieerfeitg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w69D (D:)
    amedfvrqcfnpmivelaekamkeygedlkietnkfaaicthlevcfmysdfhfineqge
    sivhrfeiiegrdrtmawtvvnsicnttgaekpkflpdlydykenrfieigvtrrevhiy
    ylekankikthihifsftgeematkadytldeesrariktrlftirqemanrglwdsfrq
    ser