PDB entry 2w67

View 2w67 on RCSB PDB site
Description: btgh84 in complex with fma34
Class: hydrolase
Keywords: glycoside hydrolase, complex, hydrolase, inhibitor, glycosidase
Deposited on 2008-12-17, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-glcnacase bt_4395
    Species: Bacteroides thetaiotaomicron VPI-5482 [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: o-glcnacase bt_4395
    Species: Bacteroides thetaiotaomicron VPI-5482 [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w67b1, d2w67b2, d2w67b3
  • Heterogens: F34, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w67B (B:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w67B (B:)
    lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
    qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrgv
    vegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqelv
    avanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnpq
    kqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtgd
    rvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvtn
    pmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpng
    hgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpli
    veitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqp
    gvktatrvikplidrtfatvvkffnqkfnahldatt