PDB entry 2w60

View 2w60 on RCSB PDB site
Description: anti citrullinated collagen type 2 antibody acc4
Class: immune system
Keywords: antibody anti-citrullin, arthritis, immune system
Deposited on 2008-12-16, released 2009-02-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.171
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-citrullinated collagen type II fab acc4
    Species: MUS MUSCULUS [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W60 (0-216)
  • Chain 'B':
    Compound: anti-citrullinated collagen type II fab acc4
    Species: MUS MUSCULUS [TaxId:10090]
    Domains in SCOPe 2.04: d2w60b1, d2w60b2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2w60B (B:)
dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpltfgagtklelkradaaptv
sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
sstltltkdeyerhnsytceathktstspivksfnrn