PDB entry 2w5u

View 2w5u on RCSB PDB site
Description: Flavodoxin from Helicobacter pylori in complex with the C3 inhibitor
Class: electron transport
Keywords: drug discovery, electron transport, protein hinhibitor, fmn, transport, flavodoxin, flavoprotein
Deposited on 2008-12-12, released 2009-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25776 (Start-163)
      • conflict (77)
      • conflict (116)
      • conflict (159)
    Domains in SCOPe 2.07: d2w5ua_
  • Chain 'B':
    Compound: flavodoxin
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25776 (Start-163)
      • conflict (77)
      • conflict (116)
      • conflict (159)
    Domains in SCOPe 2.07: d2w5ub_
  • Heterogens: FMN, IC3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w5uA (A:)
    mgkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdl
    qtdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdg
    yhfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5uA (A:)
    gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
    tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
    hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w5uB (B:)
    mgkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdl
    qtdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdg
    yhfeaskaveggkfvglvidednqddltderiskwveqvrgsfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5uB (B:)
    gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfnsftkvilvaptagagdlq
    tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
    hfeaskaveggkfvglvidednqddltderiskwveqvrgsfa