PDB entry 2w5o

View 2w5o on RCSB PDB site
Description: complex structure of the gh93 alpha-l-arabinofuranosidase of fusarium graminearum with arabinobiose
Deposited on 2008-12-11, released 2009-03-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-l-arabinofuranosidase
    Species: GIBBERELLA ZEAE [TaxId:5518]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W5O
  • Heterogens: EDO, SO4, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w5oA (A:)
    amkpaqkgktfsnveifdpptnyrdpqvlyarplelsdgtllgtwenyspeppnvwfpiv
    kskdggktwkeiskvkdtqnnwglryqpqlyelprafgkypkgtvlcsgssipsdlsetl
    ievyasrdkgytwefvshvalggealpnpgltpvwepflmtykeklilyysdqrdnaths
    qklvhqtttdlkkwskvvddtkyadyyarpgmptvaklpnneyiyvyeygggpnppagsd
    ywfpvyyrlskdpqkflnkahhqivsndgttpagspyvvwtpyggkngtivvscgtrsei
    ftnqalgdasawkkwdvpqptaytrslltfqkdpdllmimgagilppaggkntvsasvvr
    lsevmks
    

    Sequence, based on observed residues (ATOM records):
    >2w5oA (A:)
    gktfsnveifdpptnyrdpqvlyarplelsdgtllgtwenyspeppnvwfpivkskdggk
    twkeiskvkdtqnnwglryqpqlyelprafgkypkgtvlcsgssipsdlsetlievyasr
    dkgytwefvshvalggealpnpgltpvwepflmtykeklilyysdqrdnathsqklvhqt
    ttdlkkwskvvddtkyadyyarpgmptvaklpnneyiyvyeygggpnppagsdywfpvyy
    rlskdpqkflnkahhqivsndgttpagspyvvwtpyggkngtivvscgtrseiftnqalg
    dasawkkwdvpqptaytrslltfqkdpdllmimgagilppaggkntvsasvvrlsevmk