PDB entry 2w5h

View 2w5h on RCSB PDB site
Description: human nek2 kinase apo
Class: transferase
Keywords: ser/thr protein kinase, kinase, nucleus, meiosis, mitosis, cytoplasm, serine/threonine-protein kinase, metal-binding, phosphoprotein, nucleotide-binding, magnesium, cell cycle, ATP-binding, transferase, centrosome splitting, alternative splicing, coiled coil, polymorphism, cell division
Deposited on 2008-12-10, released 2008-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • engineered mutation (174)
    • PDB 2W5H (271-278)
    Domains in SCOPe 2.06: d2w5ha1, d2w5ha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w5hA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5hA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
    alkechrrshrdlkpanvfldgkqnvklgdfglarhdtsfakafvgtpyymspeqmnsyn
    eksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnl
    kdyhrpsveeilenplilehhhhhh