PDB entry 2w5b

View 2w5b on RCSB PDB site
Description: Human Nek2 kinase ATPgammaS-bound
Class: transferase
Keywords: transferase, meiosis, mitosis, metal-binding, phosphoprotein, nucleotide-binding, magnesium, cell cycle, ATP-binding, centrosome splitting, cell division
Deposited on 2008-12-08, released 2008-12-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
      • engineered mutation (174)
    Domains in SCOPe 2.04: d2w5ba_
  • Heterogens: AGS, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w5bA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5bA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
    alkechrrslhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtpyymspeqm
    nrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysdelneii
    trmlnlkdyhrpsveeilenplilehhhhhh