PDB entry 2w5a

View 2w5a on RCSB PDB site
Description: human nek2 kinase ADP-bound
Class: transferase
Keywords: ser/thr protein kinase, kinase, nucleus, meiosis, mitosis, serine/threonine-protein kinase, metal-binding, phosphoprotein, nucleotide-binding, magnesium, cell cycle, ATP-binding, transferase, centrosome splitting, cell division
Deposited on 2008-12-08, released 2008-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.173
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
      • expression tag (271-278)
    Domains in SCOPe 2.05: d2w5aa_
  • Heterogens: ADP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w5aA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w5aA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
    alkechrrslhrdlkpanvfldgkqnvklgdfglariltsfaktfvgtpyymspeqmnrm
    yneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysdelneiitrml
    nlkdyhrpsveeilenplilehhhhhh