PDB entry 2w59

View 2w59 on RCSB PDB site
Description: structure of an avian igy-fc 3-4 fragment
Class: immune system
Keywords: immunoglobulin, avian, igy fc, immune system
Deposited on 2008-12-08, released 2009-01-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.171
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igy fcu3-4
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W59
    Domains in SCOPe 2.04: d2w59a1, d2w59a2
  • Chain 'B':
    Compound: igy fcu3-4
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W59
    Domains in SCOPe 2.04: d2w59b1, d2w59b2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w59A (A:)
    dispdgaqscspiqlyaippspgelyisldaklrclvvnlpsdsslsvtwtreksgnlrp
    dpmvlqehfngtysassavpvstqdwlsgerftctvqheelplplsksvyrntgpttppl
    iypfaphpeelslsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpeertang
    aggdgdtffvyskmsvetakwnggtvfacmavhealpmrfsqrtlqkqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w59A (A:)
    piqlyaippspgelyisldaklrclvvnlpsdsslsvtwtreksgnlrpdpmvlqehfng
    tysassavpvstqdwlsgerftctvqheelplplsksvyrntgpttppliypfaphpeel
    slsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpeertangdgdtffvyskm
    svetakwnggtvfacmavhealpmrfsqrtlqkqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w59B (B:)
    dispdgaqscspiqlyaippspgelyisldaklrclvvnlpsdsslsvtwtreksgnlrp
    dpmvlqehfngtysassavpvstqdwlsgerftctvqheelplplsksvyrntgpttppl
    iypfaphpeelslsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpeertang
    aggdgdtffvyskmsvetakwnggtvfacmavhealpmrfsqrtlqkqagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w59B (B:)
    piqlyaippspgelyisldaklrclvvnlpsdsslsvtwtreksgnlrpdpmvlqehfng
    tysassavpvstqdwlsgerftctvqheelplplsksvyrntgpttppliypfaphpeel
    slsrvtlsclvrgfrprdieirwlrdhravpatefvttavlpeertandgdtffvyskms
    vetakwnggtvfacmavhealpmrfsqrtlqkqa