PDB entry 2w52

View 2w52 on RCSB PDB site
Description: 2 beta-glucans (6-o-glucosyl-laminaritriose) in both donor and acceptor sites of gh16 laminarinase 16a from phanerochaete chrysosporium.
Deposited on 2008-12-03, released 2009-07-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative laminarinase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w52A (A:)
atyhlednwvgsaflstftheaiadpthgrvnyvdqatalaknltyasgdtlilradhtt
tlspsgpgrnsvrirsiktytthvavfdvrhmpqgcgtwpaawetdegdwpnggevdiie
gvndqspnamtlhtgancampasrtmtghatnnncdvntdgntgcgvqaptansygpsfn
angggwyamertnsfikvwffprnagnvpndiasgpatintdnwgtptaffpntncdigs
hfdanniiinltfcgdwagqasifngagcpgscvdyvnnnpsafanaywdiasvrvyq