PDB entry 2w4x

View 2w4x on RCSB PDB site
Description: btgh84 in complex with stz
Class: hydrolase
Keywords: glycoside hydrolase, complex, hydrolase, inhibitor, glycosidase
Deposited on 2008-12-02, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-glcnacase bt_4395
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w4xa1, d2w4xa2, d2w4xa3
  • Heterogens: GOL, STZ, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w4xA (A:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w4xA (A:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgmlisigekgdksvrky
    srqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryr
    gvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqe
    lvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtn
    pqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwt
    gdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfv
    tnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgp
    nghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkp
    liveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpy
    qpgvktatrvikplidrtfatvvkffnqkfnahldattd