PDB entry 2w4k

View 2w4k on RCSB PDB site
Description: X-ray structure of a DAP-Kinase 2-302
Class: transferase
Keywords: phosphoprotein, calmodulin-binding, serine/threonine-protein kinase, nucleotide-binding, dapk, kinase, complex, apoptosis, ank repeat, calmodulin, transferase, ATP-binding
Deposited on 2008-11-27, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2w4ka_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w4kA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfa
    ar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w4kA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkasavnmekfkkfaa
    r