PDB entry 2w4f

View 2w4f on RCSB PDB site
Description: crystal structure of the first pdz domain of human scrib1
Class: structural protein
Keywords: structural protein, phosphoprotein, ubl conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil, polymorphism, lap4, crib1, scrb1, vartul, membrane
Deposited on 2008-11-25, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.175
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein lap4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W4F (93-96)
    • Uniprot Q14160 (2-92)
    Domains in SCOPe 2.07: d2w4fa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w4fA (A:)
    smeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgdklle
    vngvalqgaehheavealrgagtavqmrvwreretsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w4fA (A:)
    eeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgdkllevn
    gvalqgaehheavealrgagtavqmrvwreretsv