PDB entry 2w4f

View 2w4f on RCSB PDB site
Description: crystal structure of the first pdz domain of human scrib1
Class: structural protein
Keywords: structural protein, phosphoprotein, ubl conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil, polymorphism, lap4, crib1, scrb1, vartul, membrane
Deposited on 2008-11-25, released 2008-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein lap4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2W4F (93-96)
  • Uniprot Q14160 (2-92)
  Domains in SCOPe 2.08: d2w4fa1, d2w4fa2
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2w4fA (A:)
  smeeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgdklle
  vngvalqgaehheavealrgagtavqmrvwreretsv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2w4fA (A:)
  eeltltilrqtgglgisiaggkgstpykgddegifisrvseegpaaragvrvgdkllevn
  gvalqgaehheavealrgagtavqmrvwreretsv