PDB entry 2w4c

View 2w4c on RCSB PDB site
Description: Human common-type acylphosphatase variant, A99
Class: hydrolase
Keywords: hydrolase
Deposited on 2008-11-25, released 2009-12-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.198
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07311 (Start-98)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d2w4ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w4cA (A:)
    maegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvr
    hmqewletrgspkshidkanfnnekvilkldysdfqiva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w4cA (A:)
    ntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvrhmqe
    wletrgspkshidkanfnnekvilkldysdfqiva