PDB entry 2w43

View 2w43 on RCSB PDB site
Description: structure of l-haloacid dehalogenase from s. tokodaii
Class: hydrolase
Keywords: hydrolase, metabolic process
Deposited on 2008-11-21, released 2008-12-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.178
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 2-haloalkanoic acid dehalogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2w43a_
  • Chain 'B':
    Compound: hypothetical 2-haloalkanoic acid dehalogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2w43b_
  • Heterogens: PO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w43A (A:)
    miilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgee
    skfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifs
    aesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpig
    gkpdvivndfkelyewilryk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w43B (B:)
    miilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgee
    skfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifs
    aesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpig
    gkpdvivndfkelyewilryk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w43B (B:)
    iilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvrgees
    kfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkgifsa
    esvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivdpigg
    kpdvivndfkelyewilryk