PDB entry 2w3v

View 2w3v on RCSB PDB site
Description: mycobacterium avium dihydrofolate reductase complexed with nadph and trimethoprim
Class: oxidoreductase
Keywords: nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, nadp, reductase, oxidoreductase
Deposited on 2008-11-16, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium avium [TaxId:1764]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w3va_
  • Heterogens: NDP, TOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w3vA (A:)
    mtraevglvwaqstsgvigrggdipwsvpedltrfkevtmghtvimgrrtweslpakvrp
    lpgrrnvvvsrrpdfvaegarvagsleaalayagsdpapwviggaqiyllalphatrcev
    teieidlrrddddalapalddswvgetgewlasrsglryrfhsyrrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w3vA (A:)
    raevglvwaqstsgvigrggdipwsvpedltrfkevtmghtvimgrrtweslpakvrplp
    grrnvvvsrrpdfvaegarvagsleaalayagsdpapwviggaqiyllalphatrcevte
    ieidlrrddddalapalddswvgetgewlasrsglryrfhsyrrd