PDB entry 2w3s

View 2w3s on RCSB PDB site
Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Class: oxidoreductase
Keywords: xo, xdh, gout, iron, 2fe-2s, xanthine, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine, hyperuricemia, metal-binding
Deposited on 2008-11-14, released 2008-12-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.234
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54050 (0-461)
      • conflict (25)
  • Chain 'B':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54051 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.03: d2w3sb1, d2w3sb2
  • Chain 'C':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54050 (0-461)
      • conflict (25)
  • Chain 'D':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54051 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.03: d2w3sd1, d2w3sd2
  • Chain 'E':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54050 (0-461)
      • conflict (25)
  • Chain 'F':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54051 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.03: d2w3sf1, d2w3sf2
  • Chain 'G':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54050 (0-461)
      • conflict (25)
  • Chain 'H':
    Compound: Xanthine Dehydrogenase
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54051 (Start-776)
      • conflict (771)
    Domains in SCOPe 2.03: d2w3sh1, d2w3sh2
  • Heterogens: FES, FAD, MPN, CA, XAN, MOM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w3sB (B:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w3sB (B:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w3sD (D:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w3sD (D:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2w3sF (F:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w3sF (F:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2w3sH (H:)
    msvgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespg
    viavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkarity
    aprpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqa
    alalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlai
    acavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgws
    adlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehl
    argmgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtr
    lqksanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsva
    lnhggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmav
    kdacetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatg
    fyatpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpald
    igqiegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnree
    tifrskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w3sH (H:)
    svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
    iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
    prpailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaa
    lalpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaia
    cavaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsa
    dlslpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehla
    rgmgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaaw
    nstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmv
    qvaaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaa
    regcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgr
    pflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwltt
    eelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgi
    saflalhdacaacgphwpdlqapatpeavlaavrraegra