PDB entry 2w3o

View 2w3o on RCSB PDB site
Description: crystal structure of the human pnkp fha domain in complex with an xrcc1-derived phosphopeptide
Deposited on 2008-11-13, released 2009-02-03
The last revision was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional polynucleotide phosphatase/kinase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W3O
      • see remark 999 (20)
      • engineered mutation (101)
    • Uniprot Q96T60
  • Chain 'B':
    Compound: bifunctional polynucleotide phosphatase/kinase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W3O
      • see remark 999 (20)
      • engineered mutation (101)
    • Uniprot Q96T60
  • Chain 'C':
    Compound: DNA repair protein XRCC1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA repair protein XRCC1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2w3oA (A:)
gphmgeveapgrlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadp
etrtvavkqlgvnpsttgtqelkpglegslgvgdtlylvngehpltlrweetr

    Sequence, based on observed residues (ATOM records):
    >2w3oA (A:)
grlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetrtvavkql
gvnpsttgtqelkpglegslgvgdtlylvngehpltlrwe

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2w3oB (B:)
gphmgeveapgrlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadp
etrtvavkqlgvnpsttgtqelkpglegslgvgdtlylvngehpltlrweetr

    Sequence, based on observed residues (ATOM records):
    >2w3oB (B:)
grlwlesppgeappiflpsdgqalvlgrgpltqvtdrkcsrtqvelvadpetrtvavkql
gvnpsttgtqelkpglegslgvgdtlylvngehpltlrwee

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2w3oC (C:)
yagstden

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2w3oD (D:)
yagstden