PDB entry 2w39

View 2w39 on RCSB PDB site
Description: glc(beta-1-3)glc disaccharide in -1 and -2 sites of laminarinase 16a from phanerochaete chrysosporium
Deposited on 2008-11-07, released 2009-07-21
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative laminarinase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, LGC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w39A (A:)
atyhlednwvgsaflstftheaiadpthgrvnyvdqatalaknltyasgdtlilradhtt
tlspsgpgrnsvrirsiktytthvavfdvrhmpqgcgtwpaawetdegdwpnggevdiie
gvndqspnamtlhtgancampasrtmtghatnnncdvntdgntgcgvqaptansygpsfn
angggwyamertnsfikvwffprnagnvpndiasgpatintdnwgtptaffpntncdigs
hfdanniiinltfcgdwagqasifngagcpgscvdyvnnnpsafanaywdiasvrvyq