PDB entry 2w2m

View 2w2m on RCSB PDB site
Description: wt pcsk9-deltac bound to wt egf-a of ldlr
Class: hydrolase/receptor
Keywords: hydrolase-receptor complex, cardiovascular disease, familial hypercholesterolemia, lipid metabolism, serine protease, lipid transport, steroid metabolism
Deposited on 2008-11-03, released 2008-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21719
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ma_
  • Chain 'E':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01130 (27-End)
      • expression tag (19-26)
    Domains in SCOPe 2.07: d2w2me1, d2w2me2
  • Chain 'P':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2mA (A:)
    sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
    gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
    ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
    vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv
    agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalppsthgaa
    gtaaashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2mA (A:)
    sipwnleritpprggslvevylldtsiqsdhreiegrvmvtdfenvpeedskcdshgthl
    agvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvvllpla
    ggysrvlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqpvtlgt
    lgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepeltlae
    lrqrlihfsakdvineawfpedqrvltpnlvaalpps
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2w2mE (E:)
    mkhhhhhhpmsdydipttenlyfqgamgtnecldnnggcshvcndlkigyeclcpdgfql
    vaqrrcedidecqdpdtcsqlcvnleggykcqceegfqldphtkack
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2mE (E:)
    nlyfqgamgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrced
    

  • Chain 'P':
    No sequence available.