PDB entry 2w2i

View 2w2i on RCSB PDB site
Description: Crystal structure of the human 2-oxoglutarate oxygenase LOC390245
Class: oxidoreductase
Keywords: oxidoreductase, chromosome 11
Deposited on 2008-10-31, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-13, with a file datestamp of 2015-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoglutarate oxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ia_
  • Chain 'B':
    Compound: 2-oxoglutarate oxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ib_
  • Chain 'C':
    Compound: 2-oxoglutarate oxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ic_
  • Heterogens: NI, PD2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2iA (A:)
    mhhhhhhssgvdlgtenlyfqsmksvhsspqntshtimtfyptmeefadfntyvaymesq
    gahqaglakvippkewkarqmyddiediliatplqqvtsgqggvftqyhkkkkamrvgqy
    rrlanskkyqtpphqnfadleqrywkshpgnppiygadisgslfeestkqwnlghlgtil
    dlleqecgvviegvntpylyfgmwkttfawhtedmdlysinylhfgepktwyvvppehgq
    hlerlarelfpdisrgceaflrhkvalisptvlkengipfncmtqeagefmvtfpygyha
    gfnhgfncaeainfatprwidygkmasqcscgestvtfsmdpfvrivqpesyelwkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2iA (A:)
    htimtfyptmeefadfntyvaymesqgahqaglakvippkewkarqmyddiediliatpl
    qqvtsgqggvftqyhkkkkamrvgqyrrlanskkyqtpphqnfadleqrywkshpgnppi
    ygadisgslfeestkqwnlghlgtildlleqecgvviegvntpylyfgmwkttfawhted
    mdlysinylhfgepktwyvvppehgqhlerlarelfpdisaflrhkvalisptvlkengi
    pfncmtqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmavtfsmdpfvriv
    qpesy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w2iB (B:)
    mhhhhhhssgvdlgtenlyfqsmksvhsspqntshtimtfyptmeefadfntyvaymesq
    gahqaglakvippkewkarqmyddiediliatplqqvtsgqggvftqyhkkkkamrvgqy
    rrlanskkyqtpphqnfadleqrywkshpgnppiygadisgslfeestkqwnlghlgtil
    dlleqecgvviegvntpylyfgmwkttfawhtedmdlysinylhfgepktwyvvppehgq
    hlerlarelfpdisrgceaflrhkvalisptvlkengipfncmtqeagefmvtfpygyha
    gfnhgfncaeainfatprwidygkmasqcscgestvtfsmdpfvrivqpesyelwkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2iB (B:)
    htimtfyptmeefadfntyvaymesqgahqaglakvippkewkarqmyddiediliatpl
    qqvtsgqggvftqyhkkkkamrvgqyrrlanskkyqtpphqnfadleqrywkshpgnppi
    ygadisgslfeestkqwnlghlgtildlleqecgvviegvntpylyfgmwkttfawhted
    mdlysinylhfgepktwyvvppehgqhlerlarelfpdlrhkvalisptvlkengipfnc
    mtqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmavtfsmdpfvrivqpes
    yelwkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w2iC (C:)
    mhhhhhhssgvdlgtenlyfqsmksvhsspqntshtimtfyptmeefadfntyvaymesq
    gahqaglakvippkewkarqmyddiediliatplqqvtsgqggvftqyhkkkkamrvgqy
    rrlanskkyqtpphqnfadleqrywkshpgnppiygadisgslfeestkqwnlghlgtil
    dlleqecgvviegvntpylyfgmwkttfawhtedmdlysinylhfgepktwyvvppehgq
    hlerlarelfpdisrgceaflrhkvalisptvlkengipfncmtqeagefmvtfpygyha
    gfnhgfncaeainfatprwidygkmasqcscgestvtfsmdpfvrivqpesyelwkhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2iC (C:)
    htimtfyptmeefadfntyvaymesqgahqaglakvippkewkarqmyddiediliatpl
    qqvtsgqggvftqyhkkkkamrvgqyrrlanskkyqtpphqnfadleqrywkshpgnppi
    ygadisgslfeestkqwnlghlgtildlleqecgvviegvntpylyfgmwkttfawhted
    mdlysinylhfgepktwyvvppehgqhlerlarelfpdisrgceaflrhkvalisptvlk
    engipfncmtqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmavtfsmdpf
    vrivqpesyelwkh