PDB entry 2w2c

View 2w2c on RCSB PDB site
Description: structure of the tetradecameric oligomerisation domain of calcium- calmodulin dependent protein kinase II delta
Class: transferase
Keywords: serine/threonine-protein kinase, kinase, transferase, ATP-binding, phosphoprotein, calmodulin-binding, nucleotide-binding
Deposited on 2008-10-28, released 2008-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ca_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cb_
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cc_
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cd_
  • Chain 'E':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ce_
  • Chain 'F':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cf_
  • Chain 'G':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cg_
  • Chain 'H':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ch_
  • Chain 'I':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ci_
  • Chain 'J':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cj_
  • Chain 'K':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2ck_
  • Chain 'L':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cl_
  • Chain 'M':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cm_
  • Chain 'N':
    Compound: Calcium/calmodulin-dependent protein kinase type II delta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w2cn_
  • Heterogens: ACT, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w2cA (A:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cA (A:)
    ededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfy
    fenakpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwq
    nvhfhrsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w2cB (B:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cB (B:)
    dedvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyf
    enalkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwq
    nvhfhrsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w2cC (C:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cC (C:)
    edvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfe
    nankpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqn
    vhfhrsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2w2cD (D:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cD (D:)
    dvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfen
    akpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqnvh
    fhrsg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2w2cE (E:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cE (E:)
    iededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrf
    yfenakpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkw
    qnvhfhrsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2w2cF (F:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cF (F:)
    edvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfe
    nakpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqnv
    hfhrsg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2w2cG (G:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cG (G:)
    edvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfe
    nankpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqn
    vhfhrsg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2w2cH (H:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cH (H:)
    ededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfy
    fenalsnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdg
    kwqnvhfhrsg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2w2cI (I:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cI (I:)
    iededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrf
    yfenapihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwq
    nvhfhrsg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2w2cJ (J:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cJ (J:)
    dvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfen
    akpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqnvh
    fhrsg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2w2cK (K:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cK (K:)
    dvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfen
    asnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqn
    vhfhrsg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2w2cL (L:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cL (L:)
    dedvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyf
    enalsnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgk
    wqnvhfhrsg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2w2cM (M:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cM (M:)
    vkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfhrfyfena
    nkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdgkwqnvh
    fhrsg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2w2cN (N:)
    smsnttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlveg
    mdfhrfyfenalsksnkpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqsee
    trvwhrrdgkwqnvhfhrsgsptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w2cN (N:)
    ttiededvkarkqeiikvteqlieainngdfeaytkicdpgltafepealgnlvegmdfh
    rfyfenakpihtiilnphvhlvgddaaciayirltqymdgsgmpktmqseetrvwhrrdg
    kwqnvhfhrsg