PDB entry 2w1o

View 2w1o on RCSB PDB site
Description: nmr structure of dimerization domain of human ribosomal protein p2
Deposited on 2008-10-20, released 2009-11-17
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 60S acidic ribosomal protein P2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05387 (1-69)
      • expression tag (0)
  • Chain 'B':
    Compound: 60S acidic ribosomal protein P2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05387 (1-69)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w1oA (A:)
    amryvasyllaalggnsspsakdikkildsvgieadddrlnkviselngkniedviaqgi
    gklasvpagg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2w1oB (B:)
    amryvasyllaalggnsspsakdikkildsvgieadddrlnkviselngkniedviaqgi
    gklasvpagg