PDB entry 2w1f

View 2w1f on RCSB PDB site
Description: structure determination of aurora kinase in complex with inhibitor
Class: transferase
Keywords: cancer, aurora, kinase, inhibitor, nucleotide-binding, serine/threonine-protein kinase, transferase, ATP-binding, polymorphism, phosphoprotein, cell cycle
Deposited on 2008-10-17, released 2009-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.246
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2W1F (269-End)
    • Uniprot O14965 (Start-268)
    Domains in SCOPe 2.05: d2w1fa_
  • Heterogens: L0F, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w1fA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w1fA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhgtldylppemiegrmhdekvdlwslg
    vlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlre
    vlehpwitansskh