PDB entry 2w1d

View 2w1d on RCSB PDB site
Description: structure determination of aurora kinase in complex with inhibitor
Class: transferase
Keywords: nucleotide-binding, serine/threonine-protein kinase, transferase, ATP-binding, polymorphism, phosphoprotein, kinase, cancer, aurora, inhibitor, cell cycle
Deposited on 2008-10-17, released 2009-01-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-11-10, with a file datestamp of 2009-11-06.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: 0.241
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2W1D (269-End)
    • Uniprot O14965 (Start-268)
    Domains in SCOPe 2.04: d2w1da_
  • Heterogens: L0D

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w1dA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w1dA (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvgtldylppemiegrmhdkvdlwslgvl
    cyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevl
    ehpwitansskh