PDB entry 2w13

View 2w13 on RCSB PDB site
Description: high-resolution crystal structure of the p-I snake venom metalloproteinase bap1 in complex with a peptidomimetic: insights into inhibitor binding
Class: hydrolase/inhibitor
Keywords: HYDROLASE INHIBITOR COMPLEX, METZINCIN, CHEMOTAXIS, ADAMALYSINS, ENDOPEPTIDASE, METAL-BINDING, ZINC-DEPENDING, METALLOPROTEASE, METALLOPROTEINASE-INHIBITOR COMPLEX, TOXIN, SECRETED, PROTEASE, HYDROLASE, P-I SNAKE VENOM METALLOPROTEINASE, ALPHA-BETA PROTEINS, MATRIXMETALLOPROTEINASE, TUMOR NECROSIS FACTOR ALPHA CONVERTING ENZYME, PYRROLIDONE CARBOXYLIC ACID, HYDROLASE-INHIBITOR complex
Deposited on 2008-10-14, released 2009-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.131
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc metalloproteinase bap1
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2w13a_
  • Heterogens: ZN, WR2, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w13A (A:)
    erfspryielavvadhgiftkynsnlntirtrvhemlntvngfyrsvdvhaplanlevws
    kqdlikvqkdssktlksfgewrerdllprishdhaqlltavvfdgntigraytggmcdpr
    hsvgvvrdhsknnlwvavtmahelghnlgihhdtgscscgakscimasvlskvlsyefsd
    csqnqyetyltnhnpqcilnkp