PDB entry 2w11

View 2w11 on RCSB PDB site
Description: structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
Class: hydrolase
Keywords: haloacid dehalogenase, had, hydrolase
Deposited on 2008-10-13, released 2008-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-haloalkanoic acid dehalogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W11 (0-4)
    • Uniprot Q96XE7 (5-205)
    Domains in SCOPe 2.07: d2w11a1, d2w11a2
  • Chain 'B':
    Compound: 2-haloalkanoic acid dehalogenase
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W11 (Start-4)
    • Uniprot Q96XE7 (5-205)
    Domains in SCOPe 2.07: d2w11b1, d2w11b2
  • Heterogens: 2OP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w11A (A:)
    prgshmiilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilk
    vrgeeskfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryf
    kgifsaesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrknti
    vdpiggkpdvivndfkelyewilryk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2w11B (B:)
    prgshmiilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilk
    vrgeeskfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryf
    kgifsaesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrknti
    vdpiggkpdvivndfkelyewilryk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w11B (B:)
    gshmiilafdifgtvldtstviqefrnkqleytwlltimgkyvefeeitkitlryilkvr
    geeskfdeelnkwknlkayedtkylkeiseiaevyalsngsinevkqhlerngllryfkg
    ifsaesvkeykpspkvykyfldsigakeaflvssnafdvigaknagmrsifvnrkntivd
    piggkpdvivndfkelyewilryk