PDB entry 2w10
View 2w10 on RCSB PDB site
Description: mona sh3c in complex
Class: hydrolase
Keywords: alternative splicing, tpr repeat, sh2 domain, sh3 domain, coiled coil, protein phosphatase, cytoplasmic vesicle, phosphoprotein, signal tranduction, sh3 domain/complex, sh3, gads, mona, dimer, hd-ptp, hydrolase, cytoplasm
Deposited on
2008-10-13, released
2009-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-06-23, with a file datestamp of
2009-06-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- PDB 2W10 (Start-3)
- Uniprot O89100 (4-End)
Domains in SCOPe 2.05: d2w10a_ - Chain 'B':
Compound: GRB2-related adaptor protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- PDB 2W10 (0-3)
- Uniprot O89100 (4-61)
Domains in SCOPe 2.05: d2w10b_ - Chain 'C':
Compound: tyrosine-protein phosphatase non-receptor type 23
Species: MUS MUSCULUS, synthetic [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: tyrosine-protein phosphatase non-receptor type 23
Species: MUS MUSCULUS, synthetic [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2w10A (A:)
plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapm
mr
Sequence, based on observed residues (ATOM records): (download)
>2w10A (A:)
lgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2w10B (B:)
plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapm
mr
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.