PDB entry 2w10

View 2w10 on RCSB PDB site
Description: mona sh3c in complex
Class: hydrolase
Keywords: alternative splicing, tpr repeat, sh2 domain, sh3 domain, coiled coil, protein phosphatase, cytoplasmic vesicle, phosphoprotein, signal tranduction, sh3 domain/complex, sh3, gads, mona, dimer, hd-ptp, hydrolase, cytoplasm
Deposited on 2008-10-13, released 2009-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W10 (Start-3)
    • Uniprot O89100 (4-End)
    Domains in SCOPe 2.05: d2w10a_
  • Chain 'B':
    Compound: GRB2-related adaptor protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W10 (0-3)
    • Uniprot O89100 (4-61)
    Domains in SCOPe 2.05: d2w10b_
  • Chain 'C':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: tyrosine-protein phosphatase non-receptor type 23
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w10A (A:)
    plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapm
    mr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w10A (A:)
    lgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapmm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w10B (B:)
    plgsvrwaralydfealeedelgfrsgevvevldssnpswwtgrlhnklglfpanyvapm
    mr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.