PDB entry 2w0t

View 2w0t on RCSB PDB site
Description: solution structure of the fcs zinc finger domain of human lmbl2
Deposited on 2008-10-10, released 2009-01-20
The last revision was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lethal(3)malignant brain tumor-like 2 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w0tA (A:)
    gsgsepavcemcgivgtreaffsktkrfcsvscsrsyssnskk