PDB entry 2w0p
View 2w0p on RCSB PDB site
Description: crystal structure of the filamin a repeat 21 complexed with the migfilin peptide
Class: cell adhesion
Keywords: alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, filamin, complex, integrin, migfilin, receptor, polymorphism, cytoskeleton, actin-binding, cell junction, cell adhesion, metal-binding, cytoplasm, lim domain, cell shape, acetylation
Deposited on
2008-08-20, released
2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2008-12-16, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Filamin-A
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2w0pa_ - Chain 'B':
Compound: Filamin-A
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2w0pb_ - Chain 'C':
Compound: filamin-binding lim protein 1
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2w0pA (A:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps
Sequence, based on observed residues (ATOM records): (download)
>2w0pA (A:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0pB (B:)
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps
- Chain 'C':
No sequence available.