PDB entry 2w0p

View 2w0p on RCSB PDB site
Description: crystal structure of the filamin a repeat 21 complexed with the migfilin peptide
Class: cell adhesion
Keywords: alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, filamin, complex, integrin, migfilin, receptor, polymorphism, cytoskeleton, actin-binding, cell junction, cell adhesion, metal-binding, cytoplasm, lim domain, cell shape, acetylation
Deposited on 2008-08-20, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-12-16, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w0pa_
  • Chain 'B':
    Compound: Filamin-A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w0pb_
  • Chain 'C':
    Compound: filamin-binding lim protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w0pA (A:)
    ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
    ayvvqepgdyevsvkfneehipdspfvvpvasps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w0pA (A:)
    ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
    ayvvqepgdyevsvkfneehipdspfvvpvasp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w0pB (B:)
    ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
    ayvvqepgdyevsvkfneehipdspfvvpvasps
    

  • Chain 'C':
    No sequence available.