PDB entry 2w0l
View 2w0l on RCSB PDB site
Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
Class: immune system
Keywords: fibrils, germ line, antibodies, fibrinogenic, immune system
Deposited on
2008-08-19, released
2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-11-17, with a file datestamp of
2009-11-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0L (97-110)
Domains in SCOPe 2.06: d2w0la1, d2w0la2 - Chain 'B':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0L (97-110)
Domains in SCOPe 2.06: d2w0lb1, d2w0lb2 - Chain 'C':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0L (97-110)
Domains in SCOPe 2.06: d2w0lc1, d2w0lc2 - Chain 'D':
Compound: v1-22 protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5NV88 (0-97)
- PDB 2W0L (97-110)
Domains in SCOPe 2.06: d2w0ld1, d2w0ld2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0lA (A:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0lB (B:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0lC (C:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2w0lD (D:)
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl