PDB entry 2w0k

View 2w0k on RCSB PDB site
Description: crystal structure of the recombinant variable domain 6jal2
Class: immune system
Keywords: fibrils, germ line, antibodies, fibrinogenic, immune system
Deposited on 2008-08-19, released 2009-11-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
    • PDB 2W0K (98-110)
    Domains in SCOPe 2.01: d2w0ka_
  • Chain 'B':
    Compound: v1-22 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NV88 (0-97)
    • PDB 2W0K (98-110)
    Domains in SCOPe 2.01: d2w0kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w0kA (A:)
    nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w0kB (B:)
    nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl