PDB entry 2w0g

View 2w0g on RCSB PDB site
Description: hsp90 co-chaperone cdc37
Deposited on 2008-08-15, released 2008-12-09
The last revision was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hsp90 co-chaperone cdc37
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2w0gA (A:)
hktfvekyekqikhfgmlrrwddsqkylsdnvhlvceetanylviwcidleveekcalme
qvahqtivmqfilelakslkvdpracfrqfftkiktadrqymegfndeleafkervrgra
klriekamk