PDB entry 2w0f

View 2w0f on RCSB PDB site
Description: Potassium Channel KcsA-Fab Complex with Tetraoctylammonium
Class: immune system/metal transport
Keywords: IMMUNE SYSTEM METAL TRANSPORT COMPLEX, QUATERNARY AMMONIUM, PROTEIN-ANTIBODY FAB COMPLEX, IONIC CHANNEL, ION TRANSPORT, POTASSIUM CHANNEL, IMMUNE SYSTEM-METAL TRANSPORT complex
Deposited on 2008-08-14, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W0F (0-End)
    Domains in SCOPe 2.06: d2w0fa1, d2w0fa2
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2W0F (0-211)
    Domains in SCOPe 2.06: d2w0fb1, d2w0fb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • conflict (89)
    Domains in SCOPe 2.06: d2w0fc_
  • Heterogens: CO, F09, DGA, HX0, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2w0fA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w0fA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2w0fB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2w0fC (C:)
    mppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2w0fC (C:)
    alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
    pvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh