PDB entry 2w07

View 2w07 on RCSB PDB site
Description: structural determinants of polymerization reactivity of the p pilus adaptor subunit papf
Class: cell adhesion
Keywords: donor strand complementation, nte, papd, papf, pili, pilin, groove, subunit, immunoglobulin domain, donor-strand exchange, secreted, fimbrium, periplasm, p5 pocket, chaperone, cell adhesion, cell projection, pilus biogenesis, order of assembly, n-terminal extension
Deposited on 2008-08-12, released 2008-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2355
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein papd
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2w07a1, d2w07a2
  • Chain 'B':
    Compound: minor pilin subunit papf
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2w07A (A:)
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
vksanyntpylsyindyggrpvlsficngsrcsvkkek

    Sequence, based on observed residues (ATOM records): (download) 
    >2w07A (A:)
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrpnevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqt
vksanyntpylsyindyggrpvlsficngsrcsvkk

  • Chain 'B':
    No sequence available.