PDB entry 2vz4

View 2vz4 on RCSB PDB site
Description: The N-terminal domain of MerR-like protein TipAL bound to promoter DNA
Class: transcription
Keywords: transcription, resistance, antibiotic, DNA-binding, streptomyces, transcription factor, alternative initiation, transcription regulation, DNA, merr, drug, tipal, tipan, tipas, activator
Deposited on 2008-07-30, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hth-type transcriptional activator tipa
  Species: Streptomyces lividans [TaxId:1916]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A4T9 (0-End)
  Domains in SCOPe 2.08: d2vz4a_
• Chain 'B':
  Compound: 5'-d(*cp*tp*cp*cp*tp*cp*ap*cp*gp*tp *cp*ap*cp*gp*tp*gp*ap*gp*gp*tp*g)-3'
  Species: STREPTOMYCES LIVIDANS, synthetic [TaxId:1916]
  

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2vz4A (A:)
  sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp
  ldevaallddpaadprahlrrqhellsarigklqkmaaaveqamears
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vz4A (A:)
  sysvgqvagfagvtvrtlhhyddigllvpsershaghrrysdadldrlqqilfyrelgfp
  ldevaallddrahlrrqhellsarigklqkmaaaveqame
  

  
  
• Chain 'B':
  No sequence available.