PDB entry 2vz0

View 2vz0 on RCSB PDB site
Description: pteridine reductase 1 (ptr1) from trypanosoma brucei in complex with nadp and ddd00066641
Class: oxidoreductase
Keywords: oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatids, pteridine reductase
Deposited on 2008-07-29, released 2009-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vz0a_
  • Chain 'B':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vz0b_
  • Chain 'C':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vz0c_
  • Chain 'D':
    Compound: pteridine reductase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vz0d_
  • Heterogens: NAP, D64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vz0A (A:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vz0A (A:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vz0B (B:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vz0B (B:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirvn
    gvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikvd
    gglslvha
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vz0C (C:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vz0C (C:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vz0D (D:)
    meapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcq
    adltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvqgdhednsngktvetqv
    aeligtnaiapflltmsfaqrqkgtnpnctssnlsivnlcdamvdqpcmafslynmgkha
    lvgltqsaalelapygirvngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiada
    viflvsgsaqyitgsiikvdgglslvha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vz0D (D:)
    eapaavvtgaakrigraiavklhqtgyrvvihyhnsaeaavsladelnkersntavvcqa
    dltnsnvlpasceeiinscfrafgrcdvlvnnasafyptplvgktvetqvaeligtnaia
    pflltmsfaqrqsnlsivnlcdamvdqpcmafslynmgkhalvgltqsaalelapygirv
    ngvapgvsllpvamgeeekdkwrrkvplgrreasaeqiadaviflvsgsaqyitgsiikv
    dgglslvha