PDB entry 2vyw

View 2vyw on RCSB PDB site
Description: Hemoglobin (Hb2) from trematode Fasciola hepatica
Class: oxygen binding
Keywords: hemoglobin, trematode, oxygen binding
Deposited on 2008-07-29, released 2008-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: FASCIOLA HEPATICA [TaxId:6192]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYW (0-147)
    Domains in SCOPe 2.08: d2vywa_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vywA (A:)
    avltqtqidsiladlahhtdttehitemgvsiyktlfaahpeyisyfsklqgltkdnvgq
    segiryygrtlgeelirllkaasnpsvleerivqgakdhkarpvtkdqftgaapifikff
    qgllkkqedkdaiekfllhvmqaiaakm