PDB entry 2vyv

View 2vyv on RCSB PDB site
Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
Class: oxidoreductase
Keywords: contraceptive, oxidoreductase, alpha chlorohydrin, glyceraldehyde-3-phosphate, nad, gapdh, rat sperm, cytoplasm, glycolysis
Deposited on 2008-07-29, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.184
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyva1, d2vyva2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyvb1, d2vyvb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyvc1, d2vyvc2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYV (0-2)
    • Uniprot Q9ESV6 (3-333)
  • Heterogens: FMT, NAD, 1GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vyvA (A:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyvA (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vyvB (B:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyvB (B:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vyvC (C:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyvC (C:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'D':
    No sequence available.