PDB entry 2vyn

View 2vyn on RCSB PDB site
Description: structure of e.coli gapdh rat sperm gapdh heterotetramer
Class: oxidoreductase
Keywords: oxidoreductase, gapdh, contraceptive, rat sperm, glyceraldehyde-3-phosphate, alpha chlorohydrin
Deposited on 2008-07-25, released 2008-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vyna1, d2vyna2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vynb1, d2vynb2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vync1, d2vync2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYN (0-2)
    • Uniprot Q9ESV6 (3-333)
  • Heterogens: FMT, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vynA (A:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vynA (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vynB (B:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vynB (B:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vynC (C:)
    mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvev
    kdghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmt
    gpskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatt
    atqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsv
    vdltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagia
    lndnfvklvswydnetgysnkvldliahisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vynC (C:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'D':
    No sequence available.