PDB entry 2vyi

View 2vyi on RCSB PDB site
Description: crystal structure of the tpr domain of human sgt
Class: chaperone
Keywords: sgt, chaperone, tpr repeat, phosphoprotein, tetratricopeptide repeat protein, host-virus interaction
Deposited on 2008-07-24, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sgta protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYI (0-End)
    • Uniprot Q6FIA9 (Start-130)
    Domains in SCOPe 2.06: d2vyia_
  • Chain 'B':
    Compound: sgta protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vyib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vyiA (A:)
    gplgseedsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklg
    nyagavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnl
    kiaelklreap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyiA (A:)
    gpledsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnya
    gavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkia
    elklreap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vyiB (B:)
    gplgseedsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklg
    nyagavqdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnl
    kiaelklreap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vyiB (B:)
    edsaeaerlktegneqmkvenfeaavhfygkaielnpanavyfcnraaaysklgnyagav
    qdceraicidpayskaygrmglalsslnkhveavayykkaleldpdnetyksnlkiaelk
    lrea