PDB entry 2vy5

View 2vy5 on RCSB PDB site
Description: U11-48K CHHC Zn-finger protein domain
Class: splicing
Keywords: splicing, mRNA processing, transcription, nucleus, spliceosome, mRNA splicing
Deposited on 2008-07-18, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u11/u12 small nuclear ribonucleoprotein 48 kda protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VY5 (0-1)
    • Uniprot Q6IEG0 (2-36)
    Domains in SCOPe 2.07: d2vy5a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vy5A (A:)
    gsdevvicpydsnhhmpksslakhmascrlrkmgytk