PDB entry 2vy4

View 2vy4 on RCSB PDB site
Description: u11-48k chhc zn-finger domain
Class: splicing
Keywords: splicing, mRNA processing, alternative splicing, transcription, nucleus, spliceosome, polymorphism, mRNA splicing
Deposited on 2008-07-17, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u11/u12 small nuclear ribonucleoprotein 48 kda protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VY4 (0-1)
    • Uniprot Q6IEG0 (2-36)
    Domains in SCOPe 2.08: d2vy4a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vy4A (A:)
    gsdevvicpydsnhhmpksslakhmascrlrkmgytk