PDB entry 2vxs

View 2vxs on RCSB PDB site
Description: structure of il-17a in complex with a potent, fully human neutralising antibody
Class: cytokine
Keywords: epitope, complex, antibody, secreted, cytokine, glycoprotein, interleukin-17
Deposited on 2008-07-09, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: interleukin-17a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
  • Chain 'I':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
  • Chain 'J':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
  • Chain 'K':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
  • Chain 'L':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
    Domains in SCOPe 2.07: d2vxsl1, d2vxsl2
  • Chain 'M':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
    Domains in SCOPe 2.07: d2vxsm1, d2vxsm2
  • Chain 'N':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS (0-End)
    Domains in SCOPe 2.07: d2vxsn1, d2vxsn2
  • Chain 'O':
    Compound: fab fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXS
    Domains in SCOPe 2.07: d2vxso1, d2vxso2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vxsL (L:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxsL (L:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vxsM (M:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxsM (M:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vxsN (N:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxsN (N:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vxsO (O:)
    nfmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxsO (O:)
    fmltqphsvsespgktvtisctrssgslanyyvqwyqqrpgssptivifannqrpsgvpd
    rfsgsidsssnsasltisglktedeadyycqtydpysvvfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptec